Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8528_iso_2
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 468aa    MW: 51123.9 Da    PI: 6.383
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          r +WT+eE++++++a k++G   W+ I +++g ++t+ q++s+ qk+
  cra_locus_8528_iso_2_len_1932_ver_3  57 REKWTQEEHQRFLEALKLYGRA-WRQIEEHVG-TKTAIQIRSHAQKF 101
                                          789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.10652106IPR017930Myb domain
TIGRFAMsTIGR015575.1E-1655104IPR006447Myb domain, plants
SMARTSM007173.3E-1256104IPR001005SANT/Myb domain
PfamPF002494.8E-1357100IPR001005SANT/Myb domain
CDDcd001671.89E-959102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068TRG41e-153A0A068TRG4_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number